General Information

  • ID:  hor000234
  • Uniprot ID:  A0A7M7GY19
  • Protein name:  Pigment dispersing factor
  • Gene name:  LOC100577073
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSELINSLLGLPKNMNNA
  • Length:  18
  • Propeptide:  MISRKCVIILIMMLGIAYQTFGTTEDSYRNLLALNFPYDRGVNNDLQRIAKLLLLPPCLCHSKRNSELINSLLGLPKNMNNAGK
  • Signal peptide:  MISRKCVIILIMMLGIAYQTFG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A downstream effector of the circadian clock.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GY19-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000234_AF2.pdbhor000234_ESM.pdb

Physical Information

Mass: 224563 Formula: C82H140N24O28S
Absent amino acids: CDFHQRTVWY Common amino acids: N
pI: 6.41 Basic residues: 1
Polar residues: 8 Hydrophobic residues: 6
Hydrophobicity: -28.33 Boman Index: -2266
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 113.89
Instability Index: 2984.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera